sh-Oligopeptide-1 is a synthetic analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR. Thanks to bacterial gene recombination technology, this peptide is produced by bacteria (usually E. coli) from a special amino acid mix. No animal-derived materials are involved in the production process. The purified recombinant human peptide is fully functional and mimics the action of the natural growth factor.
sh-Oligopeptide-1 promotes skin repair processes, increasing the rate of self-regeneration. It enhances blood vessel generation around damaged parts of the skin and derives the secretion of rejuvenating promotional factor. Therefore, EGF heals skin injuries without scars.
It also promotes the proliferation of keratinocytes in the corneous layer, endothelial cells, and fibroblasts, improving skin barrier function, suppressing inflammatory reactions, and reducing cutaneous scars. In addition, sh-Oligopeptide-1 provides a long-term skin moisturizing effect.
As a result, sh-Oligopeptide-1 boosts the production of extracellular matrix (ECM) components, including structural and functional proteins (collagen, elastin, etc.) and glycosaminoglycans, including hyaluronic acid, revealing a youthful, healthy, and glowing appearance.