Salicylic Acid is one of the beta-hydroxy acids also called BHAs. It's a strong keratolytic (can dissolve keratin), so it used in many formulations for exfoliation, peeling, acne treatment, and so on.
Skin conditioning
In skin care, conditioning is everywhere. Consumers have always wanted their skin moisturized, nourished, restored, and protected. Each of these benefits results from the activity we call conditioning.
Here are some of the most intriguing products for providing conditioning effects. They have performance properties offering "extraordinary" conditioning for the skin.
These are specialty ingredients that create memorable, distinctive features in skincare products – the kind of features that will help offerings stand out in the minds of customers.
From phospholipids to quaternaries, the products in the line are based on exceptionally creative chemistry, making them ideal ingredients for today's personal care products. Features such as mildness, substantivity, high performance, and multifunctionality are common in modern skin conditioners.Salicyloyl Phytosphingosine is a synthetic sphingolipid derived from the combination of salicylic acid to phytosphingosine. This sphingolipid increases the synthesis of procollagen-I by skin fibroblasts (proven by in vitro study), increases essential ECM components such as fibrillin-1 and procollagen-1.
Salix Alba Bark Extract is an orange-brown to red-brown liquid with a characteristic odor. It is a natural ingredient derived from white willow bark.
This Chinese plant, Chinese Red Root Salvia (Salvia Miltiorrhiza), not to be confused with the more common Salvia Officinalis or Sage herb, has been used to increase metabolism, immunity, and blood circulation, as well as to treat coronary heart disease and ulcers.
To the ancient Arabians, Sage (Salvia Officinalis) was associated with immortality and longevity. They also credited Salvia Officinalis with increasing mental capacity.
Soapwort (Saponaria Officinalis) was obviously used in soaps. As its name implies, Soapwort forms a soap-like lather rich in saponins, which are natural cleansing agents.
Sarcosine (N-methyl glycine) is a natural amino acid found in human body tissues and ubiquitous in raw food such as egg yolks, meat, vegetables, and legume seeds.
Sasa Quelpaertensis Extract is a yellowish liquid with a characteristic odor. Sasa Quelpaertensis (Jeju Jolitdaecha) is an indigenous plant that grows only at Mt. Halla on Jeju Island, located south of the Korean peninsula.
Serenoa Serrulata fruit extract is a highly purified (>90%) lipophilic extract of Saw Palmetto berries rich in fatty acids. It is decolorized up to yield light yellow color.
Schisandra Chinensis Fruit Extract is a yellow to orange, oily liquid derived from Chinese berry grapes that restores the firmness of aged skin. It focuses on stimulating the synthesis of collagen XVII and Ladinin-1, boosting skin cohesion.
It is the most beneficial oil for aging skin. It is a source of herbal medicine with vitamins and nutrients used in anti-aging and medicinal skincare products.
From the remote Pacific islands of North Western Canada, surrounded by the Pacific Ocean in this uninhabited wilderness among some of the world's roughest waterways, it is from this naturally guarded area that the treasured green/grey glacial clay is found in rare deposits marked under designatio
Serine is a small-molecule nonessential amino acid, the precursor of Glycine, thus involved in the synthesis of collagen. It also a part of essential NMFs (natural moisturizing factors) preventing transepidermal water loss.
Sesame oil is a versatile, pale oil that is extracted from the seed. It has a rich content of Vitamin E, A, and calcium, making it particularly beneficial for dry skin and various skin conditions.
Sesame (Sesamum Indicum) was probably one of the first oil-bearing plants cultivated by man. Some authors attribute the magic formula “Open, Sesame!” to the fact observed over the millennia that the consumption of sesame has favorable effects on memory and on clear thinking.
sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of human Klotho protein that activates different Fibroblasts Growth Fatrors (FGF) and is related to lognitivity. Klotho is considered to be an anti-aging factor.
sh-Oligopeptide-1 is a synthetic analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-2 is a synthetic single chain (7.6 kDa) polypeptide hormone structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized in the liver and fibroblast cells.
sh-Oligopeptide-4 is a synthetic recombinant Thymosin-β4 peptide that helps strengthen hair while stimulating hair follicles to produce healthier hair.
sh-Oligopeptide-5 is an N-terminal fragment of human AIMP1 (ARS-interacting multi-functional protein 1).
sh-Pentapeptide-1 (former designation: Pentapeptide-1) is a synthetic recombinant peptide derived from thymopoietin, a human hormone with immunomodulating properties.
sh-Pentapeptide-5 is a synthetic recombinant peptide that mimics endorphin action and leaves a Botox-like effect. This opioid peptide effectively reduces the appearance of expression lines and deep wrinkles exposing smoother, younger-looking, and healthy skin.
sh-Polypeptide-1 is a single-chain synthetic peptide (molecular weight 17.25 kDa) hormone bFGF (basic Fibroblast Growth Factor) that regulates skin's renewal promotional subtraction It is also an essential constituent for maintaining the best condition of the body as this is concerned with restor
sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.
sh-Polypeptide-12 is a synthetic recombinant single-chain peptide, an analog of human Interleukin 4 (IL-4), that acts as an antihistamine or immune-suppressor agent to reduce scratching by inhibiting the autoimmune response.
sh-Polypeptide-121 is a synthetic single-chain recombinant peptide derived from human collagen type 21 (also called collagen alpha-1 and encoded by the COL21A1 gene). It is known under the trade name HumaColl™21.
sh-Polypeptide-19 (former rh-Oligopeptide-3) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). It boosts new dermal cell generation improving skin tone that brimming with vitality & energy.
sh-Polypeptide-2 is a synthetic recombinant analog of human Thioredoxin (TRX) that stimulates dermal cell growth and proliferation and protects them from oxidative stress. Thioredoxin is a natural cytoprotector peptide present in all human cells.
sh-Polypeptide-22 is a synthetic recombinant human transforming growth factor beta 1 (TGFβ-1) analog peptide composed of 113 amino acids.
sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.