The milky-white gelatinous substance of Royal Jelly is secreted in the salivary glands of worker bees for the sole purpose of stimulating the growth and development of queen bees.
Anti-aging
Many people consider preventing skin aging one of their most essential needs. Over the years, the cosmetic industry has strengthened this wish with new formulations and active ingredients. Consumers highly appreciate good looks and well-being.
Active anti-aging ingredients are participating in both directions. The tests on human volunteers demonstrated the positive influence of many modern ingredients and complexes against skin aging.
The active support of energy control in the cells and the prevention of DNA damage are essential steps to counteract the process of accelerated aging, often induced by UV light. The specific combinations of anti-aging ingredients and complexes do even more.
Strong regenerative effects, like stimulating collagen, support the consumer's need for well-being, resulting in improved skin elasticity and wrinkle reduction. The more consumers learn from the concepts and claims of cosmetic products containing anti-aging ingredients, the higher their expectations are. This section fulfills the increasing requirements of quickly learning consumers.Royal jelly is a mixture containing proteins, sugars, fatty acids, and B vitamins as well as antibacterial and antibiotic agents. In 2011, Japanese scientists discovered that royal jelly's effect on the evolution of bee larvae was due to a protein called Royalactin.
The extracellular matrix of human skin is comprised of collagen, elastic fibers (of which elastin is a major component), and basement membrane-associated macromolecules such as proteoglycans, fibronectin, and laminin.
Saccharomyces/Selenium Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a Selenium ion-containing medium. It is a mineral-glycopeptides complex known under the trade name the Acqua-Biomin® Selenium Y3.
Saccharomyces/Zinc Ferment is a biotechnological ingredient derived from the fermentation of living yeast cells in a zinc ion-containing medium. It is a mineral-glycopeptides complex known under the trade name the Acqua-Biomin® Zinc Y3.
Schisandra Chinensis Fruit Extract is a yellow to orange, oily liquid derived from Chinese berry grapes that restores the firmness of aged skin. It focuses on stimulating the synthesis of collagen XVII and Ladinin-1, boosting skin cohesion.
Schizophyllan is a natural polysaccharide derived from mushroom bio-fermentation. It is used in anti-aging, suncare, and products designed for mature skin.
SensAmone P5 is a peptide-based complex ingredient inspired by nature under the sea.
Serilesine® is a peptide-based ingredient with a double anti-aging action on a cellular level. It contains a peptide called Hexapeptide-10, derived from a Laminin part responsible for adhesion. The amino acid sequence of Hexapeptide-10 is Ser-Asp-Gly-Pro-Arg-Pro.
sh-Nonapeptide-4 is a synthetic recombinant peptide known under the trade name Clodessine, a fragment of human Klotho protein that activates different Fibroblasts Growth Fatrors (FGF) and is related to lognitivity. Klotho is considered to be an anti-aging factor.
sh-Oligopeptide-1 is a synthetic analog of human polypeptide EGF (Epidermal Growth Factor), which contains 53 amino acids with the sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
sh-Oligopeptide-2 is a synthetic single chain (7.6 kDa) polypeptide hormone structurally similar to proinsulin, an Insulin-like Growth Factor (IGF-1) naturally synthesized in the liver and fibroblast cells.
sh-Oligopeptide-85 is a synthetic recombinant peptide, an analog of human Dyskerin involved in stabilizing to RNA molecules and ribosome biogenesis regulation.
sh-Pentapeptide-6 Trifluoroacetate synthetic recombinant peptide that boosts stratifin protein production improving bio-messaging between skin layers (epidermal-dermal "cross-talk") and leading to dermal remodeling and wrinkle repair.
sh-Polypeptide-1 is a single-chain synthetic peptide (molecular weight 17.25 kDa) hormone bFGF (basic Fibroblast Growth Factor) that regulates skin's renewal promotional subtraction It is also an essential constituent for maintaining the best condition of the body as this is concerned with restor
sh-Polypeptide-10 is a synthetic recombinant single-chain peptide, an analog of human Fibroblast Growth Factor 10 (FGF10) that is involved in normal skin growth, regeneration, and wound repair.
sh-Polypeptide-11 (former rh-Oligopeptide-13; rh-Polypeptide-11) is known under the trade name CG-aFGF, a single-chain synthetic recombinant
sh-Polypeptide-121 is a synthetic single-chain recombinant peptide derived from human collagen type 21 (also called collagen alpha-1 and encoded by the COL21A1 gene). It is known under the trade name HumaColl™21.
sh-Polypeptide-19 (former rh-Oligopeptide-3) is a synthetic single-chain recombinant peptide, an analog of human TGF-α (Transforming Growth Factor-α). It boosts new dermal cell generation improving skin tone that brimming with vitality & energy.
sh-Polypeptide-2 is a synthetic recombinant analog of human Thioredoxin (TRX) that stimulates dermal cell growth and proliferation and protects them from oxidative stress. Thioredoxin is a natural cytoprotector peptide present in all human cells.
sh-Polypeptide-3 (former rh-Oligopeptide-5) is a single-chain synthetic recombinant peptide, an analog of human KGF (Keratinocyte Growth Factor). KGF was first described in 1989 as a human growth factor that stimulated epithelial cell proliferation.
sh-Polypeptide-4 is a synthetic analog of human SCF (Stem cell factor), a peptide of 164 amino acids. It is a cytokine that controls the survival, growth, and differentiation of hematopoietic stem cells.
sh-Polypeptide-5 is a synthetic recombinant peptide, an analog of human TGFβ3 (Transforming Growth Factor β3). It regulates the proliferation, growth, and differentiation of skin cells as a powerful multifunctional cytokine and keeps the skin young by converting old cells into new ones.
sh-Polypeptide-64 is a synthetic recombinant peptide derived from the human Aquaporin-1 (AQP-1) protein that promotes the transport of water biological membranes. AQP-1 is normally expressed in dermal cells, including keratinocytes, melanocytes, fibroblasts, and vascular endothelial cells.
sh-Polypeptide-7 is a synthetic part of human growth hormone (hGH) also called Somatotropin. It repeats 20 amino acid sequences from 191 of hGH and mimics its action, stimulating the growth, reproduction, and regeneration of skin cells.
sh-Polypeptide-8 is a synthetic single-chain recombinant analog of human PDGF (Platelet-Derived Growth Factor) that is involved in normal skin growth, healing, and wound repair.
sh-Polypeptide-9 is a synthetic recombinant analog of human VEGF (Vascular Endothelial Growth Factor). It enhances the division and migration of cytokine by increasing the permeation of serum protein in the capillary vessels.
sh-Polypeptide-93 is a synthetic recombinant human connective tissue growth factor (CTGF) analog peptide composed of 324 amino acids. It mimics an Insulin-like Growth Factor (IGF)-binding domain of CTGF regulating the expression of genes responsible for collagen production in fibroblasts.
Shorea Stenoptera Seed Butter is obtained from the fruit of the Sal tree (Shorea Robusta). The butter is extracted, further processed, and refined from its fruit to obtain a light-colored yellow butter with a low odor and smooth texture suitable for cosmetics and toiletries.